Recombinant Human FAM118A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FAM118A-453H
• Product Overview: FAM118A MS Standard C13 and N15-labeled recombinant protein (NP_060381) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: FAM118A (Family With Sequence Similarity 118 Member A) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleic acid binding. An important paralog of this gene is FAM118B.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 40.3 kDa
• AA Sequence: MDSVEKTTNRSEQKSRKFLKSLIRKQPQELLLVIGTGVSAAVAPGIPALCSWRSCIEAVIEAAEQLEVLHPGDVAEFRRKVTKDRDLLVVAHDLIRKMSPRTGDAKPSFFQDCLMEVFDDLEQHIRSPLVLQSILSLMDRGAMVLTTNYDNLLEAFGRRQNKPMESLDLKDKTKVLEWARGHMKYGVLHIHGLYRDPCGVVLDPSGYKDVTQDAEVMEVLQNLYRTKSFLFVGCGETLHDQIFQALFLYSVPNKVDLEHYMLVLKENEDHFFKHQADMLLHGIKVVSYGDCFDHFPGYVQDLATQICKQQSPDADRVDSTTLLGNACQDCAKRKLEENGIEVSKKRTQSDTDDAGGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FAM118A family with sequence similarity 118 member A [ Homo sapiens (human) ]
• Official Symbol: FAM118A
• Synonyms: FAM118A; family with sequence similarity 118, member A; C22orf8, chromosome 22 open reading frame 8; protein FAM118A; bK268H5.C22.4; FLJ20635; C22orf8
• Gene ID: 55007
• mRNA Refseq: NM_017911
• Protein Refseq: NP_060381
• UniProt ID: Q9NWS6