Recombinant Human FAM117B Protein, GST-tagged

• Cat.No.: FAM117B-3684H
• Product Overview: Human FAM117B full-length ORF (BAC04700.1, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FAM117B (Family With Sequence Similarity 117 Member B) is a Protein Coding gene. An important paralog of this gene is GLCCI1.
• Molecular Mass: 64.2 kDa
• AA Sequence: MRDKATQTESAWAEEYSEKKKGSHKRSASWGSTDQLKEIAKLRQQLQRSKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDIPDGHRAPPPLVQRSSSTRSIDTQTPGGADRGSNNSSRSQSVSPTSFLTISNEGSEESPCSADDLLVDPRDKENGNNSPLPKYATSPKPNNSYMFKREPPEGCERVKVFEECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIAVASLSTNTEQDRVSRGTSTVMPSASLLPPPEPIEEAEG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM117B family with sequence similarity 117, member B [ Homo sapiens ]
• Official Symbol: FAM117B
• Synonyms: ALS2CR13; FAM117B; family with sequence similarity 117, member B
• Gene ID: 150864
• mRNA Refseq: NM_173511
• Protein Refseq: NP_775782
• UniProt ID: Q6P1L5