Recombinant Human FAM107A Protein, GST-tagged

• Cat.No.: FAM107A-3667H
• Product Overview: Human FAM107A full-length ORF ( NP_009108.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FAM107A (Family With Sequence Similarity 107 Member A) is a Protein Coding gene. Diseases associated with FAM107A include Renal Cell Carcinoma. An important paralog of this gene is FAM107B.
• Molecular Mass: 43.9 kDa
• AA Sequence: MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM107A family with sequence similarity 107, member A [ Homo sapiens ]
• Official Symbol: FAM107A
• Synonyms: FAM107A; family with sequence similarity 107, member A; protein FAM107A; DRR1; TU3A; down-regulated in renal cell carcinoma 1; family with sequence similarity 107 member A transcript; FLJ30158; FLJ45473
• Gene ID: 11170
• mRNA Refseq: NM_001076778
• Protein Refseq: NP_001070246
• MIM: 608295
• UniProt ID: O95990