Recombinant Human FAK protein, GST-tagged
Cat.No. : | FAK-301450H |
Product Overview : | Recombinant Human FAK (381-678 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ile381-Arg678 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | ITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLKPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PTK2 protein tyrosine kinase 2 [ Homo sapiens (human) ] |
Official Symbol | FAK |
Synonyms | PTK2; FADK; FAK1; FRNK; FADK 1; PPP1R71; p125FAK; pp125FAK |
Gene ID | 5747 |
mRNA Refseq | NM_001199649 |
Protein Refseq | NP_001186578 |
MIM | 600758 |
UniProt ID | Q05397 |
◆ Recombinant Proteins | ||
FAK-301450H | Recombinant Human FAK protein, GST-tagged | +Inquiry |
FAK-12647H | Recombinant Human FAK, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAK Products
Required fields are marked with *
My Review for All FAK Products
Required fields are marked with *
0
Inquiry Basket