Recombinant Human FAHD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FAHD1-960H
Product Overview : FAHD1 MS Standard C13 and N15-labeled recombinant protein (NP_112485) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : FAHD1 (Fumarylacetoacetate Hydrolase Domain Containing 1) is a Protein Coding gene. Among its related pathways are Metabolism and Tyrosine metabolism. Gene Ontology (GO) annotations related to this gene include oxaloacetate decarboxylase activity and fumarylpyruvate hydrolase activity. An important paralog of this gene is FAHD2A.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 24.7 kDa
AA Sequence : MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIHGLVSMTFKVEKPEYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FAHD1 fumarylacetoacetate hydrolase domain containing 1 [ Homo sapiens (human) ]
Official Symbol FAHD1
Synonyms FAHD1; fumarylacetoacetate hydrolase domain containing 1; C16orf36, chromosome 16 open reading frame 36; acylpyruvase FAHD1, mitochondrial; DKFZP566J2046; YISK like/RJD15; yisK-like protein; fumarylacetoacetate hydrolase domain-containing protein 1; YISKL; C16orf36; MGC74876; DKFZp566J2046;
Gene ID 81889
mRNA Refseq NM_031208
Protein Refseq NP_112485
MIM 616320
UniProt ID Q6P587

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAHD1 Products

Required fields are marked with *

My Review for All FAHD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon