Recombinant Human FAHD1 Protein, GST-tagged

• Cat.No.: FAHD1-3651H
• Product Overview: Human FAHD1 full-length ORF ( AAH20615.1, 1 a.a. - 47 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FAHD1 (Fumarylacetoacetate Hydrolase Domain Containing 1) is a Protein Coding gene. Among its related pathways are Tyrosine metabolism and Metabolism. GO annotations related to this gene include oxaloacetate decarboxylase activity and fumarylpyruvate hydrolase activity. An important paralog of this gene is FAHD2A.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 32.1 kDa
• AA Sequence: MFQITFRCLPNFLRFGHHQEAFVKIKISTNYWPISDLLNQFDRINLQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAHD1 fumarylacetoacetate hydrolase domain containing 1 [ Homo sapiens ]
• Official Symbol: FAHD1
• Synonyms: FAHD1; fumarylacetoacetate hydrolase domain containing 1; C16orf36, chromosome 16 open reading frame 36; acylpyruvase FAHD1, mitochondrial; DKFZP566J2046; YISK like/RJD15; yisK-like protein; fumarylacetoacetate hydrolase domain-containing protein 1; YISKL; C16orf36; MGC74876; DKFZp566J2046
• Gene ID: 81889
• mRNA Refseq: NM_001018104
• Protein Refseq: NP_001018114
• MIM: 616320
• UniProt ID: Q6P587