Recombinant Human FAF1 protein, GST-tagged
Cat.No. : | FAF1-30137H |
Product Overview : | Recombinant Human FAF1 (268-489 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Arg268-Ala489 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | RSSPAQTREQSEEQITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FAF1 Fas (TNFRSF6) associated factor 1 [ Homo sapiens ] |
Official Symbol | FAF1 |
Synonyms | FAF1; Fas (TNFRSF6) associated factor 1; FAS-associated factor 1; CGI 03; hFAF1; HFAF1s; TNFRSF6 associated factor 1; UBX domain protein 3A; UBXD12; UBXN3A; TNFRSF6-associated factor 1; UBX domain-containing protein 12; UBX domain-containing protein 3A; CGI-03; FLJ37524; |
Gene ID | 11124 |
mRNA Refseq | NM_007051 |
Protein Refseq | NP_008982 |
MIM | 604460 |
UniProt ID | Q9UNN5 |
◆ Recombinant Proteins | ||
FAF1-12221Z | Recombinant Zebrafish FAF1 | +Inquiry |
FAF1-1364HFL | Recombinant Full Length Human FAF1 Protein, C-Flag-tagged | +Inquiry |
FAF1-30137H | Recombinant Human FAF1 protein, GST-tagged | +Inquiry |
FAF1-1852R | Recombinant Rat FAF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAF1-1541R | Recombinant Rhesus monkey FAF1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAF1-6470HCL | Recombinant Human FAF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAF1 Products
Required fields are marked with *
My Review for All FAF1 Products
Required fields are marked with *
0
Inquiry Basket