Recombinant Human FADS2 protein, GST-tagged

• Cat.No.: FADS2-3695H
• Product Overview: Recombinant Human FADS2 protein(1-124 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 1-124 aa
• AA Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: FADS2 fatty acid desaturase 2 [ Homo sapiens ]
• Official Symbol: FADS2
• Synonyms: FADS2; fatty acid desaturase 2; LLCDL2; D6D; delta 6 desaturase; DES6; FADSD6; SLL0262; TU13; delta-6 desaturase; delta-6-desaturase; delta(6) desaturase; delta-6 fatty acid desaturase; delta(6) fatty acid desaturase; linoleoyl-CoA desaturase (delta-6-desaturase)-like 2
• Gene ID: 9415
• mRNA Refseq: NM_004265
• Protein Refseq: NP_004256
• MIM: 606149
• UniProt ID: O95864