Recombinant Human FABP7 Full Length protein, His-tagged

Cat.No. : FABP7-2437H
Product Overview : Recombinant Human FABP7 protein(1-132 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability April 16, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-132 aa
Tag : N-His
Form : Liquid in sterile PBS, pH7.4.
Molecular Mass : The protein has a calculated MW of 19 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml.
Reconstitution : Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Gene Name FABP7 fatty acid binding protein 7, brain [ Homo sapiens ]
Official Symbol FABP7
Synonyms FABP7; fatty acid binding protein 7, brain; fatty acid-binding protein, brain; B FABP; BLBP; brain lipid binding protein; brain lipid-binding protein; fatty acid-binding protein 7; brain-type fatty acid-binding protein; mammary-derived growth inhibitor related; mammary-derived growth inhibitor-related; MRG; FABPB; B-FABP; DKFZp547J2313;
Gene ID 2173
mRNA Refseq NM_001446
Protein Refseq NP_001437
MIM 602965
UniProt ID O15540

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FABP7 Products

Required fields are marked with *

My Review for All FABP7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon