Recombinant Human FABP6 Protein, GST-tagged
Cat.No. : | FABP6-3637H |
Product Overview : | Human FABP6 full-length ORF ( AAH22489, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 39.82 kDa |
AA Sequence : | MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FABP6 fatty acid binding protein 6, ileal [ Homo sapiens ] |
Official Symbol | FABP6 |
Synonyms | FABP6; fatty acid binding protein 6, ileal; gastrotropin; I 15P; I BABP; I BALB; I BAP; ILBP; ILBP3; ileal bile acid binding protein; ILLBP; illeal lipid binding protein; GT; intestinal 15 kDa protein; ileal lipid-binding protein; illeal lipid-binding protein; I-15P; I-BAP; I-BABP; I-BALB; |
Gene ID | 2172 |
mRNA Refseq | NM_001040442 |
Protein Refseq | NP_001035532 |
MIM | 600422 |
UniProt ID | P51161 |
◆ Recombinant Proteins | ||
FABP6-655H | Recombinant Human FABP6 protein, MYC/DDK-tagged, C13/N15-labeled | +Inquiry |
FABP6-28338TH | Recombinant Human FABP6, His-tagged | +Inquiry |
FABP6-2189R | Recombinant Rat FABP6 Protein | +Inquiry |
FABP6-4425HF | Recombinant Full Length Human FABP6 Protein, GST-tagged | +Inquiry |
FABP6-484P | Recombinant Pig FABP6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP6-6475HCL | Recombinant Human FABP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FABP6 Products
Required fields are marked with *
My Review for All FABP6 Products
Required fields are marked with *
0
Inquiry Basket