Recombinant Full Length Human FABP6 Protein, GST-tagged

• Cat.No.: FABP6-4425HF
• Product Overview: Human FABP6 full-length ORF ( AAH22489, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 39.82 kDa
• Protein length: 128 amino acids
• AA Sequence: MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FABP6 fatty acid binding protein 6, ileal [ Homo sapiens ]
• Official Symbol: FABP6
• Synonyms: FABP6; fatty acid binding protein 6, ileal; gastrotropin; I 15P; I BABP; I BALB; I BAP; ILBP; ILBP3; ileal bile acid binding protein; ILLBP; illeal lipid binding protein; GT; intestinal 15 kDa protein; ileal lipid-binding protein; illeal lipid-binding protein; I-15P; I-BAP; I-BABP; I-BALB
• Gene ID: 2172
• mRNA Refseq: NM_001040442
• Protein Refseq: NP_001035532
• MIM: 600422
• UniProt ID: P51161