Recombinant Human Fatty Acid Binding Protein 5, His tagged

Cat.No. : FABP5-001H
Product Overview : Recombinant human Fatty Acid Binding Protein 5 (2-135 aa) with C-His tag was Expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2-135aa
Description : This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.
Tag : C-His
Molecular Mass : 16 kDa
AA Sequence : MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVEHHHHHHHH
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH 7.4
Concentration : 1 mg/mL by BCA
Gene Name FABP5 fatty acid binding protein 5 [ Homo sapiens (human) ]
Official Symbol FABP5
Synonyms FABP5; fatty acid binding protein 5 (psoriasis-associated); fatty acid-binding protein, epidermal; E FABP; KFABP; PA FABP; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog; EFABP; E-FABP; PAFABP; PA-FABP;
Gene ID 2171
mRNA Refseq NM_001444
Protein Refseq NP_001435
MIM 605168
UniProt ID Q01469

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FABP5 Products

Required fields are marked with *

My Review for All FABP5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon