Recombinant Human Fatty Acid Binding Protein 5, His tagged

• Cat.No.: FABP5-001H
• Product Overview: Recombinant human Fatty Acid Binding Protein 5 (2-135 aa) with C-His tag was Expressed in E. coli.

Specification

• Description: This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.
• Source: E. coli
• Species: Human
• Tag: C-His
• Protein length: 2-135aa
• Molecular Mass: 16 kDa
• AA Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVEHHHHHHHH
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH 7.4
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: FABP5 fatty acid binding protein 5 [ Homo sapiens (human) ]
• Official Symbol: FABP5
• Synonyms: FABP5; fatty acid binding protein 5 (psoriasis-associated); fatty acid-binding protein, epidermal; E FABP; KFABP; PA FABP; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog; EFABP; E-FABP; PAFABP; PA-FABP
• Gene ID: 2171
• mRNA Refseq: NM_001444
• Protein Refseq: NP_001435
• MIM: 605168
• UniProt ID: Q01469