Recombinant Human FABP5 Protein, GST-tagged

• Cat.No.: FABP5-3636H
• Product Overview: Human FABP5 full-length ORF ( AAH19385, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 40.59 kDa
• AA Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRITQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FABP5 fatty acid binding protein 5 (psoriasis-associated) [ Homo sapiens ]
• Official Symbol: FABP5
• Synonyms: FABP5; fatty acid binding protein 5 (psoriasis-associated); fatty acid-binding protein, epidermal; E FABP; KFABP; PA FABP; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog; EFABP; E-FABP; PAFABP; PA-FABP
• Gene ID: 2171
• mRNA Refseq: NM_001444
• Protein Refseq: NP_001435
• MIM: 605168
• UniProt ID: Q01469