Recombinant Human FAAP24 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FAAP24-1309H
• Product Overview: C19orf40 MS Standard C13 and N15-labeled recombinant protein (NP_689479) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: FAAP24 is a component of the Fanconi anemia (FA) core complex, which plays a crucial role in DNA damage response.
• Molecular Mass: 23.7 kDa
• AA Sequence: MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FAAP24 FA core complex associated protein 24 [ Homo sapiens (human) ]
• Official Symbol: FAAP24
• Synonyms: FAAP24; FA core complex associated protein 24; C19orf40; Fanconi anemia core complex-associated protein 24; Fanconi anemia core complex associated protein 24; Fanconi anemia-associated protein of 24 kDa
• Gene ID: 91442
• mRNA Refseq: NM_152266
• Protein Refseq: NP_689479
• MIM: 610884
• UniProt ID: Q9BTP7