Recombinant Human F8 Protein, GST-tagged

• Cat.No.: F8-3624H
• Product Overview: Human F8 full-length ORF ( NP_063916.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. Defects in this gene results in hemophilia A, a common recessive X-linked coagulation disorder. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 51 kDa
• AA Sequence: MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: F8 coagulation factor VIII, procoagulant component [ Homo sapiens ]
• Official Symbol: F8
• Synonyms: F8; coagulation factor VIII, procoagulant component; F8C; coagulation factor VIII; DXS1253E; Factor VIIIF8B; FVIII; HEMA; hemophilia A; factor VIII F8B; antihemophilic factor; coagulation factor VIIIc; AHF; F8B
• Gene ID: 2157
• mRNA Refseq: NM_000132
• Protein Refseq: NP_000123
• MIM: 300841
• UniProt ID: P00451