Recombinant Human F8 Protein, GST-tagged
Cat.No. : | F8-3624H |
Product Overview : | Human F8 full-length ORF ( NP_063916.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. Defects in this gene results in hemophilia A, a common recessive X-linked coagulation disorder. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 51 kDa |
AA Sequence : | MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | F8 coagulation factor VIII, procoagulant component [ Homo sapiens ] |
Official Symbol | F8 |
Synonyms | F8; coagulation factor VIII, procoagulant component; F8C; coagulation factor VIII; DXS1253E; Factor VIIIF8B; FVIII; HEMA; hemophilia A; factor VIII F8B; antihemophilic factor; coagulation factor VIIIc; AHF; F8B; |
Gene ID | 2157 |
mRNA Refseq | NM_000132 |
Protein Refseq | NP_000123 |
MIM | 300841 |
UniProt ID | P00451 |
◆ Recombinant Proteins | ||
F8-2397H | Recombinant Human Coagulation Factor VIII, Procoagulant Component | +Inquiry |
F8-3309R | Recombinant Rat F8 protein, His-tagged | +Inquiry |
F8-912C | Recombinant Cattle F8 Protein, His-tagged | +Inquiry |
F8-126H | Recombinant Human F8, GST-tagged | +Inquiry |
F8-3215H | Recombinant Human F8 protein, His-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
F8-6482HCL | Recombinant Human F8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F8 Products
Required fields are marked with *
My Review for All F8 Products
Required fields are marked with *
0
Inquiry Basket