Recombinant Human F8 protein, His-GST-tagged

• Cat.No.: F8-3215H
• Product Overview: Recombinant Human F8 protein(P00451)(1-216aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His-GST
• Protein length: 1-216aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 56.2 kDa
• AASequence: MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: F8 coagulation factor VIII, procoagulant component [ Homo sapiens ]
• Official Symbol: F8
• Synonyms: F8; coagulation factor VIII, procoagulant component; F8C; coagulation factor VIII; DXS1253E; Factor VIIIF8B; FVIII; HEMA; hemophilia A; factor VIII F8B; antihemophilic factor; coagulation factor VIIIc; AHF; F8B
• Gene ID: 2157
• mRNA Refseq: NM_000132
• Protein Refseq: NP_000123
• MIM: 300841
• UniProt ID: P00451