Recombinant Human F5 Protein, GST-tagged

• Cat.No.: F5-3621H
• Product Overview: Human F5 partial ORF ( NP_000121, 29 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an essential cofactor of the blood coagulation cascade. This factor circulates in plasma, and is converted to the active form by the release of the activation peptide by thrombin during coagulation. This generates a heavy chain and a light chain which are held together by calcium ions. The activated protein is a cofactor that participates with activated coagulation factor X to activate prothrombin to thrombin. Defects in this gene result in either an autosomal recessive hemorrhagic diathesis or an autosomal dominant form of thrombophilia, which is known as activated protein C resistance. [provided by RefSeq, Oct 2008]
• Molecular Mass: 36.74 kDa
• AA Sequence: AQLRQFYVAAQGISWSYRPEPTNSSLNLSVTSFKKIVYREYEPYFKKEKPQSTISGLLGPTLYAEVGDIIKVHFKNKADKPLSIHPQGIRYSKLSEGASY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: F5 coagulation factor V (proaccelerin, labile factor) [ Homo sapiens ]
• Official Symbol: F5
• Synonyms: F5; coagulation factor V (proaccelerin, labile factor); coagulation factor V; factor V Leiden; proaccelerin, labile factor; activated protein c cofactor; coagulation factor V jinjiang A2 domain; FVL; PCCF; THPH2
• Gene ID: 2153
• mRNA Refseq: NM_000130
• Protein Refseq: NP_000121
• MIM: 612309
• UniProt ID: P12259