Recombinant Human EXTL2 Protein, GST-tagged

• Cat.No.: EXTL2-3588H
• Product Overview: Human EXTL2 full-length ORF ( AAH36015, 39 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: EXTL2 (Exostosin Like Glycosyltransferase 2) is a Protein Coding gene. Diseases associated with EXTL2 include Hereditary Multiple Osteochondromas and Mucopolysaccharidoses. Among its related pathways are heparan sulfate biosynthesis and Metabolism. GO annotations related to this gene include transferase activity, transferring hexosyl groups and alpha-1,4-N-acetylgalactosaminyltransferase activity. An important paralog of this gene is EXTL3.
• Molecular Mass: 57.86 kDa
• AA Sequence: LLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNITISQFGFPYANYKRKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EXTL2 exostoses (multiple)-like 2 [ Homo sapiens ]
• Official Symbol: EXTL2
• Synonyms: EXTL2; exostoses (multiple)-like 2; exostosin-like 2; alpha 1; 4 N acteylhexosaminyltransferase; alpha-GalNAcT EXTL2; EXT-related protein 2; processed exostosin-like 2; alpha-1,4-N-acteylhexosaminyltransferase; alpha-1,4-N-acetylhexosaminyltransferase EXTL2; glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase; EXTR2
• Gene ID: 2135
• mRNA Refseq: NM_001033025
• Protein Refseq: NP_001028197
• MIM: 602411
• UniProt ID: Q9UBQ6