Recombinant Human EXTL1 Protein, GST-tagged

• Cat.No.: EXTL1-3587H
• Product Overview: Human EXTL1 partial ORF ( NP_004446, 141 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the multiple exostoses (EXT) family of glycosyltransferases, which function in the chain polymerization of heparan sulfate and heparin. The encoded protein harbors alpha 1,4- N-acetylglucosaminyltransferase activity, and is involved in chain elongation of heparan sulfate and possibly heparin. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.85 kDa
• AA Sequence: AQTGECSSMPLQWNRGRNHLVLRLHPAPCPRTFQLGQAMVAEASPTVDSFRPGFDVALPFLPEAHPLRGGAPGQLRQHSPQPGVALLALEEERGGWRTADT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EXTL1 exostoses (multiple)-like 1 [ Homo sapiens ]
• Official Symbol: EXTL1
• Synonyms: exostoses (multiple)-like 1; 3515; Ensembl:ENSG00000158008; MGC70794; exostosin-like 1;exostosin-L;multiple exostosis-like protein;alpha-N-acetylglucosaminyltransferase II;glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase;glucuronyl-N-acetylglucosaminylproteoglycan alpha-1,4-N- acetylglucosaminyltransferase;glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N- acetylglucosaminyltransferase; 2.4.1.224; EXTL
• Gene ID: 2134
• mRNA Refseq: NM_004455
• Protein Refseq: NP_004446
• MIM: 601738
• UniProt ID: Q92935