Recombinant Human EXOSC2 Protein, GST-tagged

• Cat.No.: EXOSC2-3569H
• Product Overview: Human EXOSC2 full-length ORF (BAB14043.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: EXOSC2 (Exosome Component 2) is a Protein Coding gene. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Deadenylation-dependent mRNA decay. GO annotations related to this gene include RNA binding and exoribonuclease activity.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 59.2 kDa
• AA Sequence: MAMEMRLPVARKPLSERLGRVTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EXOSC2 exosome component 2 [ Homo sapiens ]
• Official Symbol: EXOSC2
• Synonyms: EXOSC2; exosome component 2; exosome complex component RRP4; homolog of yeast RRP4 (ribosomal RNA processing 4); 3 5 exoribonuclease (RRP4); hRrp4p; p7; RRP4; Rrp4p; exosome complex exonuclease RRP4; ribosomal RNA-processing protein 4; homolog of yeast RRP4 (ribosomal RNA processing 4), 3-5-exoribonuclease; homolog of yeast RRP4 (ribosomal RNA processing 4), 3 5 exoribonuclease (RRP4)
• Gene ID: 23404
• mRNA Refseq: NM_014285
• Protein Refseq: NP_055100
• MIM: 602238
• UniProt ID: Q13868