Recombinant Human EXOC7, His-tagged
Cat.No. : | EXOC7-28334TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 361-653 of Human EXOC7 isoform 2 with N terminal His tag; 293 amino acids, 35kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 361-653 a.a. |
Description : | EXOC7 is a component of the exocyst, which is an evolutionarily conserved octameric protein complex essential for exocytosis. The exocyst targets secretory vesicles at specific domains of the plasma membrane for cell surface expansion and protein secretion (Zuo et al. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 63 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KPEFDQVLQGTAASTKNKLPGLITSMETIGAKALEDFADN IKNDPDKEYNMPKDGTVHELTSNAILFLQQLLDFQETA GAMLASQETSSSATSYSSEFSKRLLSTYICKVLGNLQL NLLSKSKVYEDPALSAIFLHNNYNYILKSLEKSELIQLVA VTQKTAERSYREHIEQQIQTYQRSWLKVTDYIAEKNLP VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWA IPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNP EKYIKYGVEQVGDMIDRLFDTSA |
Sequence Similarities : | Belongs to the EXO70 family. |
Gene Name | EXOC7 exocyst complex component 7 [ Homo sapiens ] |
Official Symbol | EXOC7 |
Synonyms | EXOC7; exocyst complex component 7; EXO70; Exo70p; KIAA1067; YJL085W; |
Gene ID | 23265 |
mRNA Refseq | NM_001013839 |
Protein Refseq | NP_001013861 |
MIM | 608163 |
Uniprot ID | Q9UPT5 |
Chromosome Location | 17q25.3 |
Pathway | Arf6 trafficking events, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Insulin Pathway, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
EXOC7-284H | Recombinant Human EXOC7, MYC/DDK-tagged | +Inquiry |
EXOC7-5377M | Recombinant Mouse EXOC7 Protein | +Inquiry |
Exoc7-2888M | Recombinant Mouse Exoc7 Protein, Myc/DDK-tagged | +Inquiry |
EXOC7-2170R | Recombinant Rat EXOC7 Protein | +Inquiry |
EXOC7-4376H | Recombinant Human EXOC7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EXOC7-6507HCL | Recombinant Human EXOC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EXOC7 Products
Required fields are marked with *
My Review for All EXOC7 Products
Required fields are marked with *
0
Inquiry Basket