Recombinant Human ETV7 Protein, GST-tagged
Cat.No. : | ETV7-3542H |
Product Overview : | Human ETV7 full-length ORF ( NP_057219.1, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the ETS family of transcription factors, which is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and differentiation, and are involved in oncogenesis as well. This protein is predominantly expressed in hematopoietic tissues. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene (PMID:11108721).[provided by RefSeq, May 2011] |
Molecular Mass : | 65.4 kDa |
AA Sequence : | MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ETV7 ets variant 7 [ Homo sapiens ] |
Official Symbol | ETV7 |
Synonyms | ETV7; ets variant 7; ets variant gene 7 (TEL2 oncogene); transcription factor ETV7; TEL 2; TEL2; TEL2 oncogene; tel-related Ets factor; ETS-related protein Tel2; ETS translocation variant 7; Ets transcription factor TEL-2b; TELB; TEL-2; |
Gene ID | 51513 |
mRNA Refseq | NM_001207035 |
Protein Refseq | NP_001193964 |
MIM | 605255 |
UniProt ID | Q9Y603 |
◆ Recombinant Proteins | ||
ETV7-785HFL | Recombinant Full Length Human ETV7 Protein, C-Flag-tagged | +Inquiry |
ETV7-4373HF | Recombinant Full Length Human ETV7 Protein, GST-tagged | +Inquiry |
ETV7-5344Z | Recombinant Zebrafish ETV7 | +Inquiry |
ETV7-875H | Recombinant Human ETV7 Protein, His (Fc)-Avi-tagged | +Inquiry |
ETV7-3542H | Recombinant Human ETV7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV7-6518HCL | Recombinant Human ETV7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ETV7 Products
Required fields are marked with *
My Review for All ETV7 Products
Required fields are marked with *
0
Inquiry Basket