Recombinant Human ETV5 protein, T7/His-tagged
Cat.No. : | ETV5-194H |
Product Overview : | Recombinant human ETV5 cDNA (510aa, Isoform-I) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 510 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELF QDLSQLQEAWLAEAQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNYCA YDRKPPSGFKPLTPPTTPLSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPP HQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYE HGVPGMPGPPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEG KVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKL SRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSPAYLLDMD RCSSLPYAEGFAY |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | ETV5 ets variant 5 [ Homo sapiens ] |
Official Symbol | ETV5 |
Synonyms | ETV5; ets variant 5; ets variant gene 5 (ets related molecule); ETS translocation variant 5; ERM; ets related molecule; ets-related molecule; ets-related protein ERM; |
Gene ID | 2119 |
mRNA Refseq | NM_004454 |
Protein Refseq | NP_004445 |
MIM | 601600 |
UniProt ID | P41161 |
Chromosome Location | 3q28 |
Pathway | Androgen Receptor Signaling Pathway, organism-specific biosystem; FOXM1 transcription factor network, organism-specific biosystem; IL12 signaling mediated by STAT4, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
Function | DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
ETV5-5524C | Recombinant Chicken ETV5 | +Inquiry |
ETV5-4371HF | Recombinant Full Length Human ETV5 Protein, GST-tagged | +Inquiry |
ETV5-3538H | Recombinant Human ETV5 Protein, GST-tagged | +Inquiry |
ETV5-26229TH | Recombinant Human ETV5 | +Inquiry |
ETV5-3278H | Recombinant Human ETV5 Protein (Ser160-Tyr510), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV5-6520HCL | Recombinant Human ETV5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ETV5 Products
Required fields are marked with *
My Review for All ETV5 Products
Required fields are marked with *
0
Inquiry Basket