Recombinant Human ETV5

• Cat.No.: ETV5-26229TH
• Product Overview: Recombinant fragment of Human ERM / Etv5 with N terminal proprietary tag, 37.73kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQR QLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQ GFKQEYHDPLYEHGVPGMPGPPAHGFQSPM
• Sequence Similarities: Belongs to the ETS family.Contains 1 ETS DNA-binding domain.

Gene Information

• Gene Name: ETV5 ets variant 5 [ Homo sapiens ]
• Official Symbol: ETV5
• Synonyms: ETV5; ets variant 5; ets variant gene 5 (ets related molecule); ETS translocation variant 5; ERM; ets related molecule
• Gene ID: 2119
• mRNA Refseq: NM_004454
• Protein Refseq: NP_004445
• MIM: 601600
• Uniprot ID: P41161
• Chromosome Location: 3q28
• Pathway: Androgen Receptor Signaling Pathway, organism-specific biosystem; FOXM1 transcription factor network, organism-specific biosystem; IL12 signaling mediated by STAT4, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem
• Function: DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding