Recombinant Human ETV4 Protein, GST-tagged

• Cat.No.: ETV4-3537H
• Product Overview: Human ETV4 full-length ORF ( AAH07242, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ETV4 (ETS Variant 4) is a Protein Coding gene. Diseases associated with ETV4 include Ewing Sarcoma and Extraosseous Ewing's Sarcoma. Among its related pathways are Transcriptional misregulation in cancer and CDK-mediated phosphorylation and removal of Cdc6. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II core promoter proximal region sequence-specific DNA binding. An important paralog of this gene is ETV1.
• Molecular Mass: 48.51 kDa
• AA Sequence: MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ETV4 ets variant 4 [ Homo sapiens ]
• Official Symbol: ETV4
• Synonyms: ETV4; ets variant 4; ets variant gene 4 (E1A enhancer binding protein, E1AF); ETS translocation variant 4; E1A enhancer binding protein; E1A F; E1AF; polyomavirus enhancer activator-3; adenovirus E1A enhancer-binding protein; polyomavirus enhancer activator 3 homolog; EWS protein/E1A enhancer binding protein chimera; ets variant gene 4 (E1A enhancer-binding protein, E1AF); PEA3; E1A-F; PEAS3
• Gene ID: 2118
• mRNA Refseq: NM_001079675
• Protein Refseq: NP_001073143
• MIM: 600711
• UniProt ID: P43268