Recombinant Human ERN2 protein, His-tagged

• Cat.No.: ERN2-3638H
• Product Overview: Recombinant Human ERN2 protein(452-563 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 452-563 aa
• AA Sequence: SLSREKLWDSELHPEEKTPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLAPADFAHISQDAQSLHSGASRRSQKRLQSPSKQAQPLDDPEAEQLTVV
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ERN2 endoplasmic reticulum to nucleus signaling 2 [ Homo sapiens ]
• Official Symbol: ERN2
• Synonyms: ERN2; endoplasmic reticulum to nucleus signaling 2; ER to nucleus signalling 2; serine/threonine-protein kinase/endoribonuclease IRE2; IRE1b; hIRE2p; IRE1 beta; inositol-requiring 1 beta; inositol-requiring protein 2; IRE1, S. cerevisiae, homolog of; endoplasmic reticulum-to-nucleus signaling 2; endoplasmic reticulum to nucleus signalling 2; IRE1-BETA
• Gene ID: 10595
• mRNA Refseq: NM_033266
• Protein Refseq: NP_150296
• MIM: 604034
• UniProt ID: Q76MJ5