Recombinant Human ERN1 Protein, GST-tagged

• Cat.No.: ERN1-3483H
• Product Overview: Human ERN1 full-length ORF ( NP_689674.2, 1 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes the transmembrane protein kinase inositol-requiring enzyme 1. The encoded protein contains two functional catalytic domains, a serine/threonine-protein kinase domain and an endoribonuclease domain. This protein functions as a sensor of unfolded proteins in the endoplasmic reticulum (ER) and triggers an intracellular signaling pathway termed the unfolded protein response (UPR). The UPR is an ER stress response that is conserved from yeast to mammals and activates genes involved in degrading misfolded proteins, regulating protein synthesis and activating molecular chaperones. This protein specifically mediates the splicing and activation of the stress response transcription factor X-box binding protein 1. [provided by RefSeq, Aug 2017]
• Molecular Mass: 33 kDa
• AA Sequence: MPARRLLLLLTLLLPGLGVSDRGAWGGGQLATAGSGPGQRRGAGAGVRAGSATAAARCPVSPAVGGSGRA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ERN1 endoplasmic reticulum to nucleus signaling 1 [ Homo sapiens ]
• Official Symbol: ERN1
• Synonyms: ERN1; endoplasmic reticulum to nucleus signaling 1; ER to nucleus signalling 1; serine/threonine-protein kinase/endoribonuclease IRE1; inositol requiring enzyme 1; IRE1; IRE1P; ire1-alpha; inositol-requiring 1; inositol-requiring enzyme 1; inositol-requiring protein 1; protein kinase/endoribonuclease; endoplasmic reticulum-to-nucleus signaling 1; IRE1a; hIRE1p; FLJ30999; MGC163277; MGC163279
• Gene ID: 2081
• mRNA Refseq: NM_001433
• Protein Refseq: NP_001424
• MIM: 604033
• UniProt ID: O75460