Recombinant Full Length Human ERN1 Protein, GST-tagged

Cat.No. : ERN1-4597HF
Product Overview : Human ERN1 full-length ORF ( NP_689674.2, 1 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 70 amino acids
Description : This gene encodes the transmembrane protein kinase inositol-requiring enzyme 1. The encoded protein contains two functional catalytic domains, a serine/threonine-protein kinase domain and an endoribonuclease domain. This protein functions as a sensor of unfolded proteins in the endoplasmic reticulum (ER) and triggers an intracellular signaling pathway termed the unfolded protein response (UPR). The UPR is an ER stress response that is conserved from yeast to mammals and activates genes involved in degrading misfolded proteins, regulating protein synthesis and activating molecular chaperones. This protein specifically mediates the splicing and activation of the stress response transcription factor X-box binding protein 1. [provided by RefSeq, Aug 2017]
Molecular Mass : 33 kDa
AA Sequence : MPARRLLLLLTLLLPGLGVSDRGAWGGGQLATAGSGPGQRRGAGAGVRAGSATAAARCPVSPAVGGSGRA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ERN1 endoplasmic reticulum to nucleus signaling 1 [ Homo sapiens ]
Official Symbol ERN1
Synonyms ERN1; endoplasmic reticulum to nucleus signaling 1; ER to nucleus signalling 1; serine/threonine-protein kinase/endoribonuclease IRE1; inositol requiring enzyme 1; IRE1; IRE1P; ire1-alpha; inositol-requiring 1; inositol-requiring enzyme 1; inositol-requiring protein 1; protein kinase/endoribonuclease; endoplasmic reticulum-to-nucleus signaling 1; IRE1a; hIRE1p; FLJ30999; MGC163277; MGC163279;
Gene ID 2081
mRNA Refseq NM_001433
Protein Refseq NP_001424
MIM 604033
UniProt ID O75460

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ERN1 Products

Required fields are marked with *

My Review for All ERN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon