Recombinant Human ERMP1 protein, His-tagged

• Cat.No.: ERMP1-7432H
• Product Overview: Recombinant Human ERMP1 protein(Q7Z2K6)(85-399aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 85-399a.a.
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 41.4 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: RTLVQLSLQQLVLRGAAGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVDVQRPTGSFSIDFLGGFTSYYDNITNVVVKLEPRDGAQHAVLANCHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEALHHAVIFLFNGAEENVLQASHGFITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATSDMLAAASKYRHGNM

Gene Information

• Gene Name: ERMP1 endoplasmic reticulum metallopeptidase 1 [ Homo sapiens ]
• Official Symbol: ERMP1
• Synonyms: endoplasmic reticulum metallopeptidase 1; 23703; Ensembl:ENSG00000099219; KIAA1815; endoplasmic reticulum metallopeptidase 1;Felix-ina;aminopeptidase Fxna;bA207C16.3 (novel protein similar to predicted yeast, plant and worm proteins); FXNA; KIAA1815; bA207C16.3
• Gene ID: 79956
• mRNA Refseq: NM_024896.2
• Protein Refseq: NP_079172.2
• MIM: 611156
• UniProt ID: B3KSB1