Recombinant Full Length Human ERMP1 Protein, GST-tagged

• Cat.No.: ERMP1-4596HF
• Product Overview: Human ERMP1 full-length ORF ( AAH31630.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ERMP1 (Endoplasmic Reticulum Metallopeptidase 1) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity and metallopeptidase activity.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 62.4 kDa
• Protein length: 317 amino acids
• AA Sequence: MFIPYLYALYLIWAVFEMFTPILGRSGSEIPPDVVLASILAGCTMILSSYFINFIYLAKSTKKTMLTLTLVCAITFLLVCSGTFFPYSSNPANPKPKRVFLQHMTRTFHDLEGNAVKRDSGIWINGFDYTGISHITPHIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEVSPRNPPHFRLISKEQTPWDSIKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPVTSKGGDYFVFYSHGLQASAWQFWIEVQVSEEHPEGMVTVAIAAHYLSGEDKRSPQLDALKEKFPDWTFPSAWVCTYDLFVF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ERMP1 endoplasmic reticulum metallopeptidase 1 [ Homo sapiens ]
• Official Symbol: ERMP1
• Synonyms: endoplasmic reticulum metallopeptidase 1; 23703; Ensembl:ENSG00000099219; KIAA1815; endoplasmic reticulum metallopeptidase 1;Felix-ina;aminopeptidase Fxna;bA207C16.3 (novel protein similar to predicted yeast, plant and worm proteins); FXNA; KIAA1815; bA207C16.3
• Gene ID: 79956
• mRNA Refseq: NM_024896
• Protein Refseq: NP_079172
• MIM: 611156
• UniProt ID: B3KSB1