Recombinant Human ERMAP Protein, GST-tagged

• Cat.No.: ERMAP-3480H
• Product Overview: Human ERMAP full-length ORF ( NP_001017922.1, 1 a.a. - 475 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 79 kDa
• AA Sequence: MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ERMAP erythroblast membrane-associated protein (Scianna blood group) [ Homo sapiens ]
• Official Symbol: ERMAP
• Synonyms: ERMAP; erythroblast membrane-associated protein (Scianna blood group); erythroblast membrane associated protein , erythroblast membrane associated protein (RD and SC blood groups) , Radin blood group , RD, SC, Scianna blood group; erythroid membrane-associated protein; Radin blood group (Rd); Scianna blood group (Sc); radin blood group antigen; scianna blood group antigen; RD; SC; PRO2801; MGC118810; MGC118811; MGC118812; MGC118813
• Gene ID: 114625
• mRNA Refseq: NM_001017922
• Protein Refseq: NP_001017922
• MIM: 609017
• UniProt ID: Q96PL5