Recombinant Human ERBIN Protein, GST-tagged

• Cat.No.: ERBIN-3446H
• Product Overview: Human ERBB2IP partial ORF ( NP_061165, 1272 a.a. - 1371 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the leucine-rich repeat and PDZ domain (LAP) family. The encoded protein contains 17 leucine-rich repeats and one PDZ domain. It binds to the unphosphorylated form of the ERBB2 protein and regulates ERBB2 function and localization. It has also been shown to affect the Ras signaling pathway by disrupting Ras-Raf interaction. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]
• Molecular Mass: 36.74 kDa
• AA Sequence: QGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ERBIN erbb2 interacting protein [ Homo sapiens (human) ]
• Official Symbol: ERBIN
• Synonyms: ERBIN; erbb2 interacting protein; ERBB2IP; erbb2 interacting protein; protein LAP2; densin 180 like protein; ERBB2 interacting protein; ERBIN; LAP2; densin-180-like protein
• Gene ID: 55914
• mRNA Refseq: NM_001006600
• Protein Refseq: NP_001006600
• MIM: 606944
• UniProt ID: Q96RT1