Recombinant Human FABP7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FABP7-1341H
• Product Overview: FABP7 MS Standard C13 and N15-labeled recombinant protein (NP_001437) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 14.9 kDa
• AA Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FABP7 fatty acid binding protein 7 [ Homo sapiens (human) ]
• Official Symbol: FABP7
• Synonyms: FABP7; fatty acid binding protein 7, brain; fatty acid-binding protein, brain; B FABP; BLBP; brain lipid binding protein; brain lipid-binding protein; fatty acid-binding protein 7; brain-type fatty acid-binding protein; mammary-derived growth inhibitor related; mammary-derived growth inhibitor-related; MRG; FABPB; B-FABP; DKFZp547J2313
• Gene ID: 2173
• mRNA Refseq: NM_001446
• Protein Refseq: NP_001437
• MIM: 602965
• UniProt ID: O15540