Recombinant Human EPT1, GST-tagged
Cat.No. : | EPT1-102H |
Product Overview : | Recombinant Human Ethanolaminephosphotransferase 1/EPT1 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Pro50) of Human EPT1 fused with a GST tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-50 a.a. |
Description : | Ethanolaminephosphotransferase 1 (EPT1) is an enzyme that belongs to the CDP-Alcohol Phosphatidyltransferase Class-I Family. EPT1 is a Selenoprotein, which contains a Selenocysteine (Sec) residue at its active site. The Selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3 UTR of Selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. EPT1 catalyzes Phosphatidylethanolamine biosynthesis from CDP-Ethanolamine. It plays a central role in the formation and maintenance of vesicular membranes. EPT1 is involved in the formation of Phosphatidylethanolamine via the Kennedy pathway. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, pH 8.0 |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMAGYEYVSPEQLAGFDKYKYSAVDTNPLSL YVMHPFWNTIVKVFPTWLAP |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
◆ Recombinant Proteins | ||
EPT1-2833M | Recombinant Mouse EPT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPT1-5271M | Recombinant Mouse EPT1 Protein | +Inquiry |
EPT1-102H | Recombinant Human EPT1, GST-tagged | +Inquiry |
EPT1-2877H | Recombinant Human EPT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPT1-862H | Recombinant Human EPT1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPT1 Products
Required fields are marked with *
My Review for All EPT1 Products
Required fields are marked with *
0
Inquiry Basket