Recombinant Human EPS15 protein(657-798aa), His-tagged

• Cat.No.: EPS15-653H
• Product Overview: Recombinant Human EPS15 protein(P42566)(657-798aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 657-798aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.9 kDa
• AASequence: CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: EPS15 epidermal growth factor receptor pathway substrate 15 [ Homo sapiens ]
• Official Symbol: EPS15
• Synonyms: EPS15; epidermal growth factor receptor pathway substrate 15; epidermal growth factor receptor substrate 15; AF 1P; MLLT5; protein AF-1p; ALL1 fused gene from chromosome 1; AF1P; AF-1P
• Gene ID: 2060
• mRNA Refseq: NM_001159969
• Protein Refseq: NP_001153441
• MIM: 600051
• UniProt ID: P42566