Recombinant Human EPPK1 Protein (1-225 aa), His-tagged

• Cat.No.: EPPK1-486H
• Product Overview: Recombinant Human EPPK1 Protein (1-225 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 27.5 kDa
• Protein length: 1-225 aa
• AA Sequence: MSGHTLPPLPVPGTNSTEQASVPRAMAATLGAGTPPRPQARSIAGVYVEASGQAQSVYAAMEQGLLPAGLGQALLEAQAATGGLVDLARGQLLPVSKALQQGLVGLELKEKLLAAERATTGYPDPYGGEKLALFQAIGKEVVDRALGQSWLEVQLATGGLVDPAQGVLVAPEPACHQGLLDRETWHKLSELEPGTGDLRFLNPNTLERLTYHQLLERCVRAPGSG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: EPPK1 epiplakin 1 [ Homo sapiens (human) ]
• Official Symbol: EPPK1
• Synonyms: EPIPL; EPIPL1
• Gene ID: 83481
• mRNA Refseq: NM_031308
• Protein Refseq: NP_112598
• UniProt ID: P58107