Recombinant Human EPPK1 Protein (1-225 aa), His-tagged
Cat.No. : | EPPK1-486H |
Product Overview : | Recombinant Human EPPK1 Protein (1-225 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-225 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 27.5 kDa |
AA Sequence : | MSGHTLPPLPVPGTNSTEQASVPRAMAATLGAGTPPRPQARSIAGVYVEASGQAQSVYAAMEQGLLPAGLGQALLEAQAATGGLVDLARGQLLPVSKALQQGLVGLELKEKLLAAERATTGYPDPYGGEKLALFQAIGKEVVDRALGQSWLEVQLATGGLVDPAQGVLVAPEPACHQGLLDRETWHKLSELEPGTGDLRFLNPNTLERLTYHQLLERCVRAPGSG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | EPPK1 epiplakin 1 [ Homo sapiens (human) ] |
Official Symbol | EPPK1 |
Synonyms | EPIPL; EPIPL1; |
Gene ID | 83481 |
mRNA Refseq | NM_031308 |
Protein Refseq | NP_112598 |
UniProt ID | P58107 |
◆ Recombinant Proteins | ||
EPPK1-486H | Recombinant Human EPPK1 Protein (1-225 aa), His-tagged | +Inquiry |
EPPK1-2825M | Recombinant Mouse EPPK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPPK1-5263M | Recombinant Mouse EPPK1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPPK1 Products
Required fields are marked with *
My Review for All EPPK1 Products
Required fields are marked with *
0
Inquiry Basket