Recombinant Human EPO protein(28-193 aa), N-MBP-His-tagged

• Cat.No.: EPO-2521H
• Product Overview: Recombinant Human EPO protein(P01588)(28-193 aa), fused with N-terminal MBP-His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&MBP
• Protein Length: 28-193 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Gene Information

• Gene Name: EPO erythropoietin [ Homo sapiens ]
• Official Symbol: EPO
• Synonyms: EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142
• Gene ID: 2056
• mRNA Refseq: NM_000799
• Protein Refseq: NP_000790
• MIM: 133170
• UniProt ID: P01588