Active Recombinant Human EPO Protein
Cat.No. : | EPO-589H |
Product Overview : | Recombinant Human EPO Protein was expressed without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | Erythropoietin (EPO), a glycoprotein produced primarily by the kidney, is the principal factor that regulates erythropoiesis by stimulating the proliferation and differentiation of erythroid progenitor cells. The production of EPO by kidney cells is increased in response to hypoxia or anemia. Recombinant EPO has been approved for the treatment of anemia associated with chronic renal failure as well as for anemia of AZT treated AIDS patients. |
Form : | Sterile Filtered White lyophil |
Bio-activity : | Fully biologically active when compared to standard. The Specific Activity was measured by the stimulation of reticulocyte production in normocyth-aemic mice and is no less than 1.5×10^5 IU/mg. |
AA Sequence : | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
Endotoxin : | Less than 0.01 EU/μg of rHuEPO-a as determined by LAL method. |
Purity : | > 98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in sodium citrate buffer. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. |
Gene Name | EPO erythropoietin [ Homo sapiens (human) ] |
Official Symbol | EPO |
Synonyms | EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142; |
Gene ID | 2056 |
mRNA Refseq | NM_00799 |
Protein Refseq | NP_00790 |
MIM | 133170 |
UniProt ID | P01588 |
◆ Recombinant Proteins | ||
Epo-01R | Active Recombinant Rat Epo protein, His-tagged | +Inquiry |
EPO-3602Z | Recombinant Zebrafish EPO | +Inquiry |
EPO-4401H | Recombinant Human EPO Protein, His (Fc)-Avi-tagged | +Inquiry |
EPO-100E | Recombinant Equine EPO | +Inquiry |
Epo-966M | Active Recombinant Mouse Epo Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPO-1450MCL | Recombinant Mouse EPO cell lysate | +Inquiry |
EPO-592RCL | Recombinant Rat EPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPO Products
Required fields are marked with *
My Review for All EPO Products
Required fields are marked with *
0
Inquiry Basket