Recombinant Human EPHA7 Protein, GST-tagged

• Cat.No.: EPHA7-3394H
• Product Overview: Human EPHA7 full-length ORF ( AAH27940.1, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Increased expression of this gene is associated with multiple forms of carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]
• Molecular Mass: 56.32 kDa
• AA Sequence: MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EPHA7 EPH receptor A7 [ Homo sapiens ]
• Official Symbol: EPHA7
• Synonyms: EPHA7; EPH receptor A7; EphA7; ephrin type-A receptor 7; Hek11; EK11; EHK-3; EPH-like kinase 11; EPH homology kinase 3; Eph homology kinase-3; receptor protein-tyrosine kinase HEK11; tyrosine-protein kinase receptor EHK-3; EHK3; HEK11
• Gene ID: 2045
• mRNA Refseq: NM_004440
• Protein Refseq: NP_004431
• MIM: 602190
• UniProt ID: Q15375