Recombinant Human EPHA6 Protein, GST-tagged

• Cat.No.: EPHA6-3392H
• Product Overview: Human EPHA6 partial ORF ( XP_114973, 613 a.a. - 712 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: EPHA6 (EPH Receptor A6) is a Protein Coding gene. Diseases associated with EPHA6 include Oculoauricular Syndrome. Among its related pathways are MAPK-Erk Pathway and Developmental Biology. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is EPHA3.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: PSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDGKFHCCSLKTDP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EPHA6 EPH receptor A6 [ Homo sapiens ]
• Official Symbol: EPHA6
• Synonyms: EPHA6; EPH receptor A6; ephrin type-A receptor 6; FLJ35246; EHK-2; EPH-like kinase 12; EPH homology kinase 2; ephrin receptor EphA6; EK12; EPA6; PRO57066; DKFZp434C1418
• Gene ID: 285220
• mRNA Refseq: NM_001080448
• Protein Refseq: NP_001073917
• MIM: 600066
• UniProt ID: Q9UF33