Recombinant Human EPHA6 Protein, GST-tagged
Cat.No. : | EPHA6-3392H |
Product Overview : | Human EPHA6 partial ORF ( XP_114973, 613 a.a. - 712 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | EPHA6 (EPH Receptor A6) is a Protein Coding gene. Diseases associated with EPHA6 include Oculoauricular Syndrome. Among its related pathways are MAPK-Erk Pathway and Developmental Biology. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is EPHA3. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | PSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDGKFHCCSLKTDP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EPHA6 EPH receptor A6 [ Homo sapiens ] |
Official Symbol | EPHA6 |
Synonyms | EPHA6; EPH receptor A6; ephrin type-A receptor 6; FLJ35246; EHK-2; EPH-like kinase 12; EPH homology kinase 2; ephrin receptor EphA6; EK12; EPA6; PRO57066; DKFZp434C1418; |
Gene ID | 285220 |
mRNA Refseq | NM_001080448 |
Protein Refseq | NP_001073917 |
MIM | 600066 |
UniProt ID | Q9UF33 |
◆ Recombinant Proteins | ||
Epha6-1725M | Recombinant Mouse Eph Receptor A6 | +Inquiry |
EPHA6-461H | Recombinant Human EPHA6 | +Inquiry |
EPHA6-3392H | Recombinant Human EPHA6 Protein, GST-tagged | +Inquiry |
EPHA6-3391H | Active Recombinant Human EPHA6 Protein, GST-tagged | +Inquiry |
Epha6-4064M | Recombinant Mouse Epha6 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHA6-2126MCL | Recombinant Mouse EPHA6 Overexpression Lysate | +Inquiry |
EPHA6-2502MCL | Recombinant Mouse EPHA6 Overexpression Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPHA6 Products
Required fields are marked with *
My Review for All EPHA6 Products
Required fields are marked with *
0
Inquiry Basket