Recombinant Human EPHA5 Protein, GST-tagged

• Cat.No.: EPHA5-3390H
• Product Overview: Human EPHA5 partial ORF ( NP_004430, 234 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013]
• Molecular Mass: 36.63 kDa
• AA Sequence: PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EPHA5 EPH receptor A5 [ Homo sapiens ]
• Official Symbol: EPHA5
• Synonyms: EPHA5; EPH receptor A5; EphA5; ephrin type-A receptor 5; CEK7; EHK1; Hek7; TYRO4; EK7; EHK-1; EPH-like kinase 7; EPH homology kinase 1; Eph homology kinase-1; brain-specific kinase; receptor protein-tyrosine kinase HEK7; tyrosine-protein kinase receptor EHK-1; HEK7
• Gene ID: 2044
• mRNA Refseq: NM_004439
• Protein Refseq: NP_004430
• MIM: 600004
• UniProt ID: P54756