Recombinant Human EPHA1 Protein, GST-tagged
Cat.No. : | EPHA1-3375H |
Product Overview : | Human EPHA1 partial ORF ( NP_005223, 394 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene is expressed in some human cancer cell lines and has been implicated in carcinogenesis. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.51 kDa |
AA Sequence : | PGARGLTTPAVHVNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLTYELHVLNQDEERYQMVLEPR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EPHA1 EPH receptor A1 [ Homo sapiens ] |
Official Symbol | EPHA1 |
Synonyms | EPHA1; EPH receptor A1; EphA1 , EPHT, EPHT1; ephrin type-A receptor 1; EPH; hEpha1; oncogene EPH; eph tyrosine kinase 1; soluble EPHA1 variant 1; soluble EPHA1 variant 2; tyrosine-protein kinase receptor EPH; erythropoietin-producing hepatoma receptor; erythropoietin-producing hepatoma amplified sequence; EPHT; EPHT1; MGC163163; |
Gene ID | 2041 |
mRNA Refseq | NM_005232 |
Protein Refseq | NP_005223 |
MIM | 179610 |
UniProt ID | P21709 |
◆ Recombinant Proteins | ||
EPHA1-6869H | Recombinant Human EPHA1 protein, His & T7-tagged | +Inquiry |
Epha1-299M | Recombinant Mouse Epha1, GST-tagged, Active | +Inquiry |
EPHA1-163H | Active Recombinant Human EPHA1, Fc Chimera | +Inquiry |
Epha1-349M | Active Recombinant Mouse Epha1, His-tagged | +Inquiry |
Epha1-6870M | Recombinant Mouse Epha1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHA1-1700MCL | Recombinant Mouse EPHA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPHA1 Products
Required fields are marked with *
My Review for All EPHA1 Products
Required fields are marked with *
0
Inquiry Basket