Recombinant Human EPHA1 Protein, GST-tagged

• Cat.No.: EPHA1-3375H
• Product Overview: Human EPHA1 partial ORF ( NP_005223, 394 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene is expressed in some human cancer cell lines and has been implicated in carcinogenesis. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.51 kDa
• AA Sequence: PGARGLTTPAVHVNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLTYELHVLNQDEERYQMVLEPR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EPHA1 EPH receptor A1 [ Homo sapiens ]
• Official Symbol: EPHA1
• Synonyms: EPHA1; EPH receptor A1; EphA1 , EPHT, EPHT1; ephrin type-A receptor 1; EPH; hEpha1; oncogene EPH; eph tyrosine kinase 1; soluble EPHA1 variant 1; soluble EPHA1 variant 2; tyrosine-protein kinase receptor EPH; erythropoietin-producing hepatoma receptor; erythropoietin-producing hepatoma amplified sequence; EPHT; EPHT1; MGC163163
• Gene ID: 2041
• mRNA Refseq: NM_005232
• Protein Refseq: NP_005223
• MIM: 179610
• UniProt ID: P21709