Recombinant Human EPB41L4A Protein, GST-tagged

• Cat.No.: EPB41L4A-3358H
• Product Overview: Human EPB41L4A full-length ORF ( AAH31042.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the band 4.1 protein superfamily. Members of this superfamily are thought to play an important role in regulating interactions between the cytoskeleton and plasma membrane, and contain an amino terminal conserved domain that binds glycophorin C. This gene product is thought to be involved in the beta-catenin signaling pathway. [provided by RefSeq, Dec 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 47.8 kDa
• AA Sequence: MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EPB41L4A erythrocyte membrane protein band 4.1 like 4A [ Homo sapiens ]
• Official Symbol: EPB41L4A
• Synonyms: EPB41L4A; erythrocyte membrane protein band 4.1 like 4A; band 4.1-like protein 4A; NBL4; erythrocyte protein band 4.1-like 4; EPB41L4; FLJ38738; DKFZp566L203
• Gene ID: 64097
• mRNA Refseq: NM_022140
• Protein Refseq: NP_071423
• MIM: 612141
• UniProt ID: Q9HCS5