Recombinant Human EPAS1 protein, His-tagged

• Cat.No.: EPAS1-3021H
• Product Overview: Recombinant Human EPAS1 protein(521-870 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 521-870 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: FNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: EPAS1 endothelial PAS domain protein 1 [ Homo sapiens ]
• Official Symbol: EPAS1
• Synonyms: EPAS1; endothelial PAS domain protein 1; endothelial PAS domain-containing protein 1; bHLHe73; HIF 1 alpha like factor; HIF2A; HLF; MOP2; PASD2; EPAS-1; HIF2-alpha; HIF-2-alpha; HIF-1alpha-like factor; HIF-1-alpha-like factor; member of PAS protein 2; PAS domain-containing protein 2; hypoxia-inducible factor 2 alpha; hypoxia-inducible factor 2-alpha; basic-helix-loop-helix-PAS protein MOP2; class E basic helix-loop-helix protein 73; ECYT4
• Gene ID: 2034
• mRNA Refseq: NM_001430
• Protein Refseq: NP_001421
• MIM: 603349
• UniProt ID: Q99814