Recombinant Human EP300 Protein, His-tagged

Cat.No. : EP300-85H
Product Overview : Recombinant Human EP300 Protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer.
Form : Supplied as a 0.2 μm filtered solution in 20mM Tris, 150mM NaCl (pH8.0).
Molecular Mass : ~11.4 kDa
AA Sequence : MGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKLEHHHHHH
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.26 mg/ml
Gene Name EP300 E1A binding protein p300 [ Homo sapiens (human) ]
Official Symbol EP300
Synonyms p300; KAT3B; MKHK2; RSTS2
Gene ID 2033
mRNA Refseq NM_001362843
Protein Refseq NP_001349772
MIM 602700
UniProt ID Q9Y6B2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EP300 Products

Required fields are marked with *

My Review for All EP300 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon