Recombinant Human ENTPD2 Protein, GST-tagged

• Cat.No.: ENTPD2-3332H
• Product Overview: Human ENTPD2 partial ORF ( NP_982293.1, 187 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is the type 2 enzyme of the ecto-nucleoside triphosphate diphosphohydrolase family (E-NTPDase). E-NTPDases are a family of ecto-nucleosidases that hydrolyze 5'-triphosphates. This ecto-ATPase is an integral membrane protein. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
• Molecular Mass: 35.53 kDa
• AA Sequence: GRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ENTPD2 ectonucleoside triphosphate diphosphohydrolase 2 [ Homo sapiens ]
• Official Symbol: ENTPD2
• Synonyms: ENTPD2; ectonucleoside triphosphate diphosphohydrolase 2; CD39L1; CD39 like 1; ecto ATPase; NTPDase 2; ecto-ATPase 2; ecto-ATPDase 2; CD39 antigen-like 1; ecto-ATP diphosphohydrolase 2; NTPDase-2
• Gene ID: 954
• mRNA Refseq: NM_001246
• Protein Refseq: NP_001237
• MIM: 602012
• UniProt ID: Q9Y5L3