Recombinant Human ENPEP, GST-tagged

• Cat.No.: ENPEP-27665TH
• Product Overview: Recombinant fragment: DLHVKPLLE EDTYTGTVSI SINLSAPTRY LWLHLRETRI TRLPELKRPS GDQVQVRRCF EYKKQEY, corresponding to amino acids 103-168 of Human BP1; GST tag is about 25-26 kDa and BP1 with GST tag is about 35 kDa.66 amino acids, 35kDa.

Specification

• Description: Glutamyl aminopeptidase also known as aminopeptidase A is an enzyme encoded by the ENPEP gene. Glutamyl aminopeptidase has also recently been designated CD249 (cluster of differentiation 249).
• Conjugation: GST
• Source: E. coli
• Tissue specificity: Expressed by epithelial cells of the proximal tubule cells and the glomerulus of the nephron. Also found in a variety of other tissues.
• Form: Liquid
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 50mM Tris acetate, 1mM EDTA, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: DLHVKPLL EEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEY
• Sequence Similarities: Belongs to the peptidase M1 family.
• Protein length: 103-168 a.a.

Gene Information

• Gene Name: ENPEP glutamyl aminopeptidase (aminopeptidase A) [ Homo sapiens ]
• Official Symbol: ENPEP
• Synonyms: ENPEP; glutamyl aminopeptidase (aminopeptidase A); glutamyl aminopeptidase; CD249; gp160
• Gene ID: 2028
• mRNA Refseq: NM_001977
• Protein Refseq: NP_001968
• MIM: 138297
• Uniprot ID: Q07075
• Chromosome Location: 4q25
• Pathway: Renin-angiotensin system, organism-specific biosystem; Renin-angiotensin system, conserved biosystem
• Function: aminopeptidase activity; metal ion binding; metalloexopeptidase activity; peptidase activity; zinc ion binding