Recombinant Human ENHO Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ENHO-5359H
• Product Overview: ENHO MS Standard C13 and N15-labeled recombinant protein (NP_940975) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: ENHO (Energy Homeostasis Associated) is a Protein Coding gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 7.7 kDa
• AA Sequence: MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ENHO energy homeostasis associated [ Homo sapiens (human) ]
• Official Symbol: ENHO
• Synonyms: ENHO; energy homeostasis associated; UNQ470; C9orf165; adropin; GAAI470; energy homeostasis-associated protein
• Gene ID: 375704
• mRNA Refseq: NM_198573
• Protein Refseq: NP_940975
• MIM: 618556
• UniProt ID: Q6UWT2