Recombinant Human ENDOU protein, T7/His-tagged

• Cat.No.: ENDOU-222H
• Product Overview: Recombinant human ENDOU cDNA (368aa, Isoform-II, derived from BC074729) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 368 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGEFRACISLVLAVLCGLAWAEDHKESEPLPQLEEETEEALASNLYSAPTS CQGRCYEAFDKHHQCHCNARCQEFGNCCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLN SQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAV MKELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLV DYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTW DKSTYGNGKKYIATAYIVSST
• Purity: >90% by SDS-PAGE.
• Applications: 1. May be used for in vitro ENDOU mediated placenta derived cell & tumor cells differentiation regulations study with this protein as either soluble factor or coating matrix protein.2. May be used for ENDOU protein-protein interaction mapping.3. Potential biomarker protein for clinical applications such as monitoring pancreatic cancer progression.4. As antigen for specific antibody production.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: ENDOU endonuclease, polyU-specific [ Homo sapiens (human) ]
• Official Symbol: ENDOU
• Synonyms: ENDOU; P11; PP11; PRSS26; endonuclease, polyU-specific; 22 serine protease; 26 serine protease; placental protein 11; uridylate-specific endoribonuclease; EC 3.1.-.-
• Gene ID: 8909
• mRNA Refseq: NM_001172439
• Protein Refseq: NP_001165910
• MIM: 606720
• UniProt ID: P21128
• Chromosome Location: 12q13.1
• Function: RNA binding; endoribonuclease activity; growth factor activity