Recombinant Human EMR4P Protein, GST-tagged
Cat.No. : | EMR4P-3294H |
Product Overview : | Human EMR4 partial ORF ( XP_377506, 21 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. A protein expressed by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, this gene may represent a transcribed pseudogene. [provided by RefSeq, Aug 2008] |
Molecular Mass : | 33.77 kDa |
AA Sequence : | GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADGRE4P adhesion G protein-coupled receptor E4, pseudogene [ Homo sapiens (human) ] |
Official Symbol | EMR4P |
Synonyms | ADGRE4P; adhesion G protein-coupled receptor E4, pseudogene; Adhesion G Protein-Coupled Receptor E4, Pseudogene; Egf-Like Module Containing, Mucin-Like, Hormone Receptor-Like 4 Pseudogene; G Protein-Coupled Receptor 127; GPR127; EMR4P; PGR16; EMR4; Egf-Like Module Containing, Mucin-Like, Hormone Receptor-Like 4; EGF-Like Module-Containing Mucin-Like Hormone Receptor-Like 4; G-Protein Coupled Receptor PGR16; G-Protein Coupled Receptor 127; EGF-Like Module Receptor 4; EGF-TM7 Receptor EMR4; FIRE; EGF-TM7 receptor EMR4; G protein-coupled receptor 127; egf-like module containing, mucin-like, hormone receptor-like 4 pseudogene |
Gene ID | 326342 |
MIM | 612305 |
UniProt ID | Q86SQ3 |
◆ Recombinant Proteins | ||
EMR4P-3294H | Recombinant Human EMR4P Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EMR4P Products
Required fields are marked with *
My Review for All EMR4P Products
Required fields are marked with *
0
Inquiry Basket